Catalog Number:  C22-105-01B3
Source:  Escherichia coli.
Molecular Weight:  Approximately 28.8 kDa, a single non-glycosylated polypeptide chain containing 264 amino acids.
Quantity:  5μg/25μg/1000μg
AA Sequence:  GASSGGLGPVVRCEPCDARALAQCAPPPAVCAELVREPGCGCCLTCALSEGQPCGIYTERCG
 SGLRCQPSPDEARPLQALLDGRGLCVNASAVSRLRAYLLPAPPAPGNASESEEDRSAGEVESP
 SVSSTHRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRRE
 MEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYT
 TKGKEDVHCYS MQSK
Purity:  >98% by SDS-PAGE and HPLC analyses.
Biological Activity:  Fully biologically active when compared to standard. The ED50 determined by inhibiting IGF-II
 induced proliferation ofserum free human MCF-7 cells is less than 200 ng/ml, corresponding to a specific activity of＞ 5.0 × 103 IU/mg in the presence of 15ng/ml of rHuIGF-II.
Physical Appearance:  Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation:  Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Endotoxin:  Less than 1EU/μg of rHuIGF-BP3 as determined by LAL method.
Reconstitution:  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the
 bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a
 concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and
 stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.
Storage:  This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage,
 preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For
 maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to
 -70°C. Avoid repeated freeze/thaw cycles.
Usage:  This material is offered by Shanghai Corning Bio-Tech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.

Human Insulin-like Growth Factor-Binding Protein 3
Insulin-like Growth Factor-Binding Protein 3(IGF-BP3) is a 30 kDa cysteine-rich secreted protein. It is the major IGF binding
protein present in the plasma of human and animals and it is also found in α-granules of platelets. In addition to its ability to
modulate the activity of IGF-I and IGF-II, IGF-BP3 exerts inhibitory effects on follicle stimulating hormone (FSH) activity.
Decreased plasma levels of IGF-BP3 often results in dwarfism, whereas elevated levels of IGF-BP3 may lead to acromegaly. The
expression of IGF-BP3 in fibroblasts is stimulated by mitogenic growth factors such as Bombesin, Vasopressin, PDGF, and EGF.